PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010941766.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family TALE
Protein Properties Length: 560aa    MW: 62203.7 Da    PI: 7.1488
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010941766.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox33.29.1e-113984351954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++++LA+++gL+ +qV++WF N R +
  XP_010941766.1 398 FEHflHPYPSDADKQQLARRTGLSRNQVSNWFINARVR 435
                     564459******************************88 PP

2BELL119.71.3e-38260329372
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      e+q+kkakLls+l+eVdkrY++y +q+q+vi+sF+ v+g g+a+pYt lA ka+SrhFrcLkdai +q+
  XP_010941766.1 260 FEHQRKKAKLLSMLDEVDKRYNHYSNQMQMVINSFDSVMGFGAATPYTILARKAMSRHFRCLKDAINKQL 329
                     599*****************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.4E-54179327IPR006563POX domain
PfamPF075263.6E-45186325IPR006563POX domain
PROSITE profilePS5007113.2376439IPR001356Homeobox domain
CDDcd000861.96E-13379440No hitNo description
SMARTSM003891.5E-11379443IPR001356Homeobox domain
SuperFamilySSF466892.61E-17381446IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.0E-29382445IPR009057Homeodomain-like
PfamPF059201.4E-19396435IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 560 aa     Download sequence    Send to blast
MSPTSSASMS HGLHQRMTTC QEHDQMQHHI AQQSRRDKLR VQGFEATNLH PLDQIEDKRL  60
DLGTLELART GSILSNMFNF PAAGLADQIS DINRLPPKPA AEFSGEWYGD KGAVMGGNFN  120
SWGDTVTDSA TMQLLLMNMP SQEPYPRSTT FGNGSFSGGV VENQGLSLSL SSSLHQLEMG  180
GVSLMRYTRF ARAATELLEE VCSVWREHLK ERRSRRQLSS SNPNYPNPSF SCANGASSGR  240
VGDSSSSPKN LSSLSSADKF EHQRKKAKLL SMLDEVDKRY NHYSNQMQMV INSFDSVMGF  300
GAATPYTILA RKAMSRHFRC LKDAINKQLK QVCELLGEKE AGSTSGISKG ETPRLRLLEQ  360
NLRQRRPFHQ IGIMDSEAWR PQRGLPERSV NVLRAWLFEH FLHPYPSDAD KQQLARRTGL  420
SRNQVSNWFI NARVRLWKPM VEEMYQQEVK EEEEDVKEGE EANPRRPLSP SHHNSPQGQG  480
PEANATGSAA TAAAAHQSND DTILMGIDAP TSAMDLCGAD MEPMDDLCGA GMRLGATGDV  540
SLTLGLRHAG NLSEKNWFYG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-18385443563Homeobox protein Meis2
3k2a_B8e-18385443563Homeobox protein Meis2
4xrm_A7e-18385443563Homeobox protein Meis2
4xrm_B7e-18385443563Homeobox protein Meis2
4xrs_A6e-18385442158Homeobox protein Meis1
4xrs_B6e-18385442158Homeobox protein Meis1
5bng_A7e-18385443159Homeobox protein Meis2
5bng_B7e-18385443159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010941786.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_010941776.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_010941766.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-129BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM0TL801e-158M0TL80_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr7P27440_0011e-157(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-103BEL1-like homeodomain 4